PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_54762.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 99aa    MW: 11044.7 Da    PI: 10.4843
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_54762.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.5e-181966148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WTt Ed +l ++v+++G g+W+++ +  g+ R++k+c++rw ++l
  Rsa1.0_54762.1_g00001.1 19 KGPWTTTEDAILTEYVRKHGEGNWNAVLKNSGLLRCGKSCRLRWANHL 66
                             79******************************99**********9996 PP

2Myb_DNA-binding22.52.6e-077298128
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIa 28
                             +g+++++E+++++++++++G++ W++ a
  Rsa1.0_54762.1_g00001.1 72 KGSFSPDEEKIIIELHAKMGNK-WARMA 98
                             799*******************.*9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.991470IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-231469IPR009057Homeodomain-like
SMARTSM007172.1E-131868IPR001005SANT/Myb domain
PfamPF002494.9E-161966IPR001005SANT/Myb domain
SuperFamilySSF466898.24E-262096IPR009057Homeodomain-like
CDDcd001676.03E-102166No hitNo description
Gene3DG3DSA:1.10.10.604.0E-137099IPR009057Homeodomain-like
PROSITE profilePS5129410.3027199IPR017930Myb domain
PfamPF002492.1E-67298IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 99 aa     Download sequence    Send to blast
MHGGGETTAT VTEARGLKKG PWTTTEDAIL TEYVRKHGEG NWNAVLKNSG LLRCGKSCRL  60
RWANHLRPNL KKGSFSPDEE KIIIELHAKM GNKWARMAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-20179825105MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895361e-147AC189536.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH003D18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626947.11e-64PREDICTED: transcription factor GAMYB-like
SwissprotA2WW876e-47GAM1_ORYSI; Transcription factor GAMYB
SwissprotQ0JIC25e-47GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLA0A078JJT31e-64A0A078JJT3_BRANA; BnaCnng51960D protein
TrEMBLA0A078JMC62e-64A0A078JMC6_BRANA; BnaAnng27960D protein
TrEMBLA0A0D3B4J11e-64A0A0D3B4J1_BRAOL; Uncharacterized protein
STRINGBra022888.1-P2e-63(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.23e-55myb domain protein 101